attorney

The best 1000 domain, country, IP Number, Extension, Country are given in this section

Domain IP Number Extension Country
georgetowncriminalattorney.com 52.11.37.152 com United States
braytonlaw.com 104.16.108.239 com United States
roadrage.com 184.168.131.241 com United States
klonarislaw.com 65.75.78.111 com Bahamas
accidentattorneynewyork.com 104.16.111.239 com United States
gmpcomplaw.com 108.179.217.213 com United States
mslaw.com 34.198.182.201 com United States
petrolaw.com 209.17.116.7 com United States
estateplanningattorney-claremont.com 198.71.206.172 com United States
brennan-defense.com 167.68.37.150 com United States
foreclosureattorneysriverside.com 107.180.20.86 com United States
trucker-lawyer.com 104.16.112.239 com United States
lc.org 24.249.80.179 org United States
bcmillerlaw.com 104.239.245.56 com United States
lenoircityattorney.com 184.168.221.35 com United States
forsythcountydui.com 216.146.46.10 com United States
primetechpatents.com 69.89.25.153 com United States
abogadodefamiliafortlauderdale.com 184.168.131.241 com United States
lependorf.com 104.24.122.178 com United States
divorceattorneybryan.com 50.63.202.47 com United States
oregondvattorney.com 141.8.225.75 com Switzerland
top-dwi-attorneys.com 141.8.225.31 com Switzerland
bovitz-spitzer.com 108.167.177.180 com United States
a2attorney.com 216.239.32.21 com United States
lemoncarlawyer.com 108.167.183.54 com United States
trendl-translations.com 109.237.132.50 com Germany
rivkindlaw.com 104.27.174.142 com United States
jhmlawoffice.com 64.41.136.122 com United States
bplegal.com 23.253.147.156 com United States
classattorneysblog.com 192.186.39.151 com United States
abogadoluisvega.com 184.171.255.66 com United States
jackkilroy.com 66.96.149.32 com United States
atlantaapartmentinjuryattorneys.com 216.21.239.197 com United States
playter.com 52.24.184.195 com United States
rodsutherlandlaw.com 52.24.184.195 com United States
mcgiplaw.com 104.16.109.239 com United States
marhomesinc.com 184.168.131.241 com United States
georgetownlaw.com 166.78.1.95 com United States
demuniz.com 23.236.62.147 com United States
arborypsilaw.com 173.201.243.128 com United States
slnlaw.com 104.18.45.249 com United States
kgslaw.com 184.168.131.241 com United States
immig-chicago.com 207.21.205.162 com Canada
arbitrade.com.ua 5.39.10.93 ua France
harsheylawoffice.com 72.167.191.69 com United States
idahoworkerscompensationattorney.com 98.158.194.90 com United States
oceancountylawfirm.com 50.87.146.133 com United States
martinsvilleattorney.com 74.220.199.6 com United States
shezadmalik.com 64.41.139.56 com United States
bankruptcyinfairfax.com 216.40.47.17 com Canada
arbitratedallas.com 184.168.131.241 com United States
indyfranchiselaw.com 165.227.104.129 com United States
camarenolaw.com 143.95.251.22 com United States
nyfamilyimmigrationattorneys.com 184.168.221.91 com United States
orangecountyprobatelawfirm.com 184.168.131.241 com United States
ceobusinesscenters.com 23.236.62.147 com United States
californiajoblaw.com 64.34.186.41 com Canada
divorceattorneysmassachusetts.com 35.186.238.101 com United States
jeffreybragman.com 184.168.131.241 com United States
qdrotime.com 184.168.221.11 com United States
duensingkippen.com 74.208.236.130 com United States
topekamedicalmalpracticelawyer.com 209.59.154.88 com United States
russellhanlon.com 104.24.101.202 com United States
abrego-law.com 184.168.131.241 com United States
wisconsin-dui.com 184.168.131.241 com United States
cce-vic.com 205.178.189.131 com United States
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15


Please Wait !...